PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_65843.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 27810.4 Da    PI: 9.8092
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_65843.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.44.3e-29959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien++ rqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs +g+lyey+s
  MLOC_65843.1  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSARGRLYEYAS 59
                  79***********************************************86 PP

2K-box1028e-3483173999
         K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                    + + +++ qqe+akL+++i +Lq+ +Rhl+G+++++L++keL+ Le++L+ks+ +iRskK+ell ++ie++qk e +lq+en++Lr+k++
  MLOC_65843.1  83 IDVNSQQYFQQESAKLRQQILSLQNANRHLMGDSVGNLTVKELKTLENRLDKSIGRIRSKKHELLSAEIEYMQKLEADLQSENMYLRAKVA 173
                   5667889**********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.969161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.15E-31274IPR002100Transcription factor, MADS-box
CDDcd002653.44E-42271No hitNo description
PRINTSPR004044.2E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-313859IPR002100Transcription factor, MADS-box
PfamPF014865.9E-2785172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.26488178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRGRIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFSA RGRLYEYASN  60
STRTTIDRYK KASASSSGSA PAIDVNSQQY FQQESAKLRQ QILSLQNANR HLMGDSVGNL  120
TVKELKTLEN RLDKSIGRIR SKKHELLSAE IEYMQKLEAD LQSENMYLRA KVADAERLAL  180
APASGGGELE VLPTFDARSY YQHQVNMLQD AAAASSSSRY SQSSQPQTAA AAAAATALHL  240
GYEIKGGQAQ LN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19173173Myocyte-specific enhancer factor 2B
1tqe_Q2e-19173173Myocyte-specific enhancer factor 2B
1tqe_R2e-19173173Myocyte-specific enhancer factor 2B
1tqe_S2e-19173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5570490.0EU557049.1 Hordeum vulgare MIKC-type MADS-box transcription factor WM27B mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266821.11e-134uncharacterized protein LOC100832541
RefseqXP_010230319.11e-134PREDICTED: uncharacterized protein LOC100832541 isoform X1
SwissprotQ8RU311e-115MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLB2CZ820.0B2CZ82_HORVU; MIKC-type MADS-box transcription factor WM27B
TrEMBLM0Y5C40.0M0Y5C4_HORVD; Uncharacterized protein
STRINGMLOC_65843.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.18e-86MIKC_MADS family protein